제품 > 항체 > 다중클론항체(pAb)

GJD2 Rabbit pAb (A2883)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using GJD2 antibody (A2883) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

Overview

Product name	GJD2 Rabbit pAb
Catalog No.	A2883
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a member of the connexin protein family. Connexins are gap junction proteins which are arranged in groups of 6 around a central pore to form a connexon, a component of the gap junction intercellular channel. The channels formed by this protein allow cationic molecule exchange between human beta cells and may function in the regulation of insulin secretion.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 99-197 of human GJD2 (NP_065711.1).
Sequence	HQSAKQRERRYSTVFLALDRDPPESIGGPGGTGGGGSGGGKREDKKLQNAIVNGVLQNTENTSKETEPDCLEVKELTPHPSGLRTASKSKLRRQEGISR
Gene ID
Swiss Prot
Synonyms	CX36; GJA9
Calculated MW	36kDa
Observed MW	37kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:200 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HL-60, Jurkat, SH-SY5Y, Mouse pancreas, Mouse eye, Mouse brain, Rat pancreas, Rat eye, Rat brain
Cellular location	Cell junction, Cell membrane, Multi-pass membrane protein, gap junction