제품 > 항체 > 단일클론항체(mAb)

GLUT3/SLC2A3 Rabbit mAb (A4137)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GLUT3/SLC2A3 Rabbit mAb (A4137) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunoprecipitation - GLUT3/SLC2A3 Rabbit mAb (A4137)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain using 3 μg GLUT3/SLC2A3 antibody (A4137). Western blot was performed from the immunoprecipitate using GLUT3/SLC2A3 antibody (A4137) at a dilution of 1:1000.

Overview

Product name	GLUT3/SLC2A3 Rabbit mAb
Catalog No.	A4137
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0917

Background

Enables dehydroascorbic acid transmembrane transporter activity; glucose binding activity; and glucose transmembrane transporter activity. Involved in glucose import across plasma membrane and transport across blood-brain barrier. Is integral component of plasma membrane. Biomarker of Alzheimer's disease; acanthosis nigricans; diabetes mellitus; and type 2 diabetes mellitus.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GLUT3/SLC2A3 (P11169).
Sequence	MGTQKVTPALIFAITVATIGSFQFGYNTGVINAPEKIIKEFINKTLTDKGNAPPSEVLLTSLWSLSVAIFSVGGMIGSFSVGLFVNRFGRRNSMLIVNLL
Gene ID
Swiss Prot
Synonyms	GLUT3; GLUT3/SLC2A3
Calculated MW	54kDa
Observed MW	48-60kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:4000 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunoprecipitation
Positive samples	HepG2, Jurkat, SH-SY5Y, Mouse testis, Mouse brain, Rat testis, Rat brain
Cellular location	Cell membrane, Multi-pass membrane protein, Perikaryon, Cell projection.
Customer validation	WB(Homo sapiens, Mus musculus) IP(Homo sapiens, Mus musculus)