제품 > 항체 > 다중클론항체(pAb)

GOSR2 Rabbit pAb (A4321)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of various cell lines, using GOSR2 antibody (A4321) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Overview

Product name	GOSR2 Rabbit pAb
Catalog No.	A4321
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a trafficking membrane protein which transports proteins among the medial- and trans-Golgi compartments. Due to its chromosomal location and trafficking function, this gene may be involved in familial essential hypertension.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-190 of human GOSR2 (NP_004278.2).
Sequence	MDPLFQQTHKQVHEIQSCMGRLETADKQSVHIVENEIQASIDQIFSRLERLEILSSKEPPNKRQNARLRVDQLKYDVQHLQTALRNFQHRRHAREQQERQREELLSRTFTTNDSDTTIPMDESLQFNSSLQKVHNGMDDLILDGHNILDGLRTQRLTLKGTQKKILDIANMLGLSNTVMRLIEKRAFQDK
Gene ID
Swiss Prot
Synonyms	Bos1; EPM6; GS27; MYOS
Calculated MW	25kDa
Observed MW	24kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	A-549, HT-29, MCF7, HT-1080, HepG2, K-562
Cellular location	Golgi apparatus, Golgi apparatus membrane, Single-pass type IV membrane protein, cis-Golgi network membrane