Review (1)Publication (5) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using GOT2 Rabbit mAb (A19245) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded rat brain using GOT2 Rabbit mAb (A19245) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded human liver using GOT2 Rabbit mAb (A19245) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
| Product name | GOT2 Rabbit mAb |
|---|---|
| Catalog No. | A19245 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC2405 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human GOT2 (P00505). |
|---|---|
| Sequence | MALLHSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIG |
| Gene ID | |
| Swiss Prot | |
| Synonyms | KAT4; DEE82; KATIV; KYAT4; mitAAT; GOT2 |
| Calculated MW | 48kDa |
| Observed MW | 42kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry |
| Positive samples | HepG2, K-562, SH-SY5Y, Mouse liver, Mouse brain, Mouse kidney, Rat liver, Rat brain, Rat kidney |
| Cellular location | Cell membrane, Mitochondrion matrix |
| Customer validation | (HeLa、T-47D、HepG2、RPMI-8226、MCF7、U2-OS、PC-3、MOLT-4) WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A19245? Please let us know so that we can cite the reference in this datasheet.
