제품 > 항체 > 단일클론항체(mAb)

GP6/GPVI Rabbit mAb (A24110)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Flow cytometry: 1X10^6 MOLT-4 cells (negative control, left) and HEL cells (right) were surface-stained with GP6/GPVI Rabbit mAb (A24110, 2 μg/mL, orange line) or ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, blue line), followed by ABflo® 594-conjugated Goat Anti-Rabbit IgG (H+L) staining. Non-fluorescently stained cells were used as blank control (red line).

Flow cytometry: 1X10^6 HEL cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or GP6/GPVI Rabbit mAb (A24110, 2 μg/mL, right).

Overview

Product name	GP6/GPVI Rabbit mAb
Catalog No.	A24110
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64454

Background

This gene encodes a platelet membrane glycoprotein of the immunoglobulin superfamily. The encoded protein is a receptor for collagen and plays a critical role in collagen-induced platelet aggregation and thrombus formation. The encoded protein forms a complex with the Fc receptor gamma-chain that initiates the platelet activation signaling cascade upon collagen binding. Mutations in this gene are a cause of platelet-type bleeding disorder-11 (BDPLT11). Alternatively spliced transcript variants encoding multiple isoforms have been observed for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 21-267 of human GP6/GPVI (NP_057447.5).
Sequence	QSGPLPKPSLQALPSSLVPLEKPVTLRCQGPPGVDLYRLEKLSSSRYQDQAVLFIPAMKRSLAGRYRCSYQNGSLWSLPSDQLELVATGVFAKPSLSAQPGPAVSSGGDVTLQCQTRYGFDQFALYKEGDPAPYKNPERWYRASFPIITVTAAHSGTYRCYSFSSRDPYLWSAPSDPLELVVTGTSVTPSRLPTEPPSPVAEFSEATAELTVSFTNEVFTTETSRSITASPKESDSPAGPARQYYTK
Gene ID
Swiss Prot
Synonyms	GPIV; GPVI; BDPLT11; GP6/GPVI
Calculated MW	37kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	FC 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Flow Cytometry
Positive samples
Cellular location	Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

GP6/GPVI Rabbit mAb images

Flow CytoMetry - GP6/GPVI Rabbit mAb (A24110)

Flow cytometry: 1X10^6 HEL cells were surface-stained with ABflo® 594 Rabbit IgG isotype control (A23821, 5 μl/Test, left) or GP6/GPVI Rabbit mAb (A24110, 2 μg/mL, right).

* For research use only. Not for therapeutic or diagnostic purposes.