Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | GPC6 Rabbit pAb |
---|---|
Catalog No. | A2741 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 320-530 of human GPC6 (NP_005699.1). |
---|---|
Sequence | SEAIMNMQENSMQVSAKVFQGCGQPKPAPALRSARSAPENFNTRFRPYNPEERPTTAAGTSLDRLVTDIKEKLKLSKKVWSALPYTICKDESVTAGTSNEEECWNGHSKARYLPEIMNDGLTNQINNPEVDVDITRPDTFIRQQIMALRVMTNKLKNAYNGNDVNFQDTSDESSGSGSGSGCMDDVCPTEFEFVTTEAPAVDPDRREVDSS |
Gene ID | |
Swiss Prot | |
Synonyms | OMIMD1 |
Calculated MW | 63kDa |
Observed MW | 63kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T, HeLa |
Cellular location | Cell membrane, Extracellular side, GPI-anchor, Lipid-anchor, Secreted, extracellular space |
Customer validation | WB(Rattus norvegicus) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A2741? Please let us know so that we can cite the reference in this datasheet.