제품 > 항체 > 다중클론항체(pAb)

GPR55 Rabbit pAb (A12890)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using GPR55 Rabbit pAb (A12890) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - GPR55 Rabbit pAb (A12890)

Immunofluorescence analysis of paraffin-embedded rat bone marrow using GPR55 Rabbit pAb (A12890) at dilution of 1:100. Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	GPR55 Rabbit pAb
Catalog No.	A12890
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene belongs to the G-protein-coupled receptor superfamily. The encoded integral membrane protein is a likely cannabinoid receptor. It may be involved in several physiological and pathological processes by activating a variety of signal transduction pathways.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 210-319 of human GPR55 (NP_005674.2).
Sequence	GRRDHTQDWVQQKACIYSIAASLAVFVVSFLPVHLGFFLQFLVRNSFIVECRAKQSISFFLQLSMCFSNVNCCLDVFCYYFVIKEFRMNIRAHRPSRVQLVLQDTTISRG
Gene ID
Swiss Prot
Synonyms	LPIR1; GPR55
Calculated MW	37kDa
Observed MW	37kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	Mouse brain, Rat liver
Cellular location	Cell membrane, Multi-pass membrane protein
Customer validation	WB(Homo sapiens)