제품 > 항체 > 다중클론항체(pAb)

GPR62 Rabbit pAb (A16163)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from SH-SY5Y cells, using GPR62 Rabbit pAb (A16163) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 90s.

Overview

Product name	GPR62 Rabbit pAb
Catalog No.	A16163
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables arrestin family protein binding activity. Involved in G protein-coupled receptor signaling pathway; inositol phosphate-mediated signaling; and positive regulation of cAMP-mediated signaling. Located in endosome and plasma membrane. Part of receptor complex.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 150-250 of human GPR62 (NP_543141.3).
Sequence	GTPPAPPPAPARCSVLAGGLGPFRPLWALLAFALPALLLLGAYGGIFVVARRAALRPPRPARGSRLHSDSLDSRLSILPPLRPRLPGGKAALAPALAVGQF
Gene ID
Swiss Prot
Synonyms	GPCR8; KPG_005; GPR62
Calculated MW	38kDa
Observed MW	39kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	SH-SY5Y
Cellular location	Cell membrane, Multi-pass membrane protein