Reviews (3)Publications (2) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of Y79 cells, using GRK1 antibody (A6497).
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Immunofluorescence analysis of rat retina using GRK1 Polyclonal Antibody (A6497) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
Immunofluorescence analysis of mouse retina using GRK1 Polyclonal Antibody (A6497) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.
| Product name | GRK1 Rabbit pAb |
|---|---|
| Catalog No. | A6497 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-160 of human GRK1 (NP_002920.1). |
|---|---|
| Sequence | MDFGSLETVVANSAFIAARGSFDGSSSQPSRDKKYLAKLKLPPLSKCESLRDSLSLEFESVCLEQPIGKKLFQQFLQSAEKHLPALELWKDIEDYDTADNDLQPQKAQTILAQYLDPQAKLFCSFLDEGIVAKFKEGPVEIQDGLFQPLLQATLAHLGQA |
| Gene ID | |
| Swiss Prot | |
| Synonyms | RK; RHOK; GPRK1 |
| Calculated MW | 64kDa |
| Observed MW | 65kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | Y79 |
| Cellular location | Lipid-anchor, Membrane |
| Customer validation | (Zebrafish) WB(Danio rerio) IF(Danio rerio) IHC(Danio rerio) IF(Danio rerio) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A6497? Please let us know so that we can cite the reference in this datasheet.
_IF_01.jpg?t=1695888536 "ABclonal:Immunofluorescence - GRK1 Rabbit pAb (A6497)")
_IF_02.jpg?t=1695888536 "ABclonal:Immunofluorescence - GRK1 Rabbit pAb (A6497)")
