Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GSDMD (Full Length+N terminal) Rabbit pAb |
---|---|
Catalog No. | A24476 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse GSDMD (Full Length+N terminal) (NP_081236.1). |
---|---|
Sequence | MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGM |
Gene ID | |
Swiss Prot | |
Synonyms | GSDMD; DF5L; DFNA5L; FKSG10; GSDMDC1; gasdermin-D; GSDMD (Full Length+N terminal) |
Calculated MW | 53kDa/32kDa |
Observed MW | 53kDa/60kDa/39kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence Immunoprecipitation |
Positive samples | HT-29, 293T transfected with GSDMD-N, 293T transfected with GSDMD |
Cellular location | |
Customer validation | WB(Rattus norvegicus, Homo sapiens) IF(Homo sapiens) IF(Gallus gallus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A24476? Please let us know so that we can cite the reference in this datasheet.