GSDMD (Full Length+N terminal) Rabbit pAb (A24476)

Publications (5) Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Overview

Product name	GSDMD (Full Length+N terminal) Rabbit pAb
Catalog No.	A24476
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Gasdermin D is a member of the gasdermin family. Members of this family appear to play a role in regulation of epithelial proliferation. Gasdermin D has been suggested to act as a tumor suppressor. Alternatively spliced transcript variants have been described.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of mouse GSDMD (Full Length+N terminal) (NP_081236.1).
Sequence	MPSAFEKVVKNVIKEVSGSRGDLIPVDSLRNSTSFRPYCLLNRKFSSSRFWKPRYSCVNLSIKDILEPSAPEPEPECFGSFKVSDVVDGNIQGRVMLSGM
Gene ID
Swiss Prot
Synonyms	GSDMD; DF5L; DFNA5L; FKSG10; GSDMDC1; gasdermin-D; GSDMD (Full Length+N terminal)
Calculated MW	53kDa/32kDa
Observed MW	53kDa/60kDa/39kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HT-29, 293T transfected with GSDMD-N, 293T transfected with GSDMD
Cellular location
Customer validation	WB(Rattus norvegicus, Homo sapiens) IF(Homo sapiens) IF(Gallus gallus)