Reviews (3)Publications (15) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GSDMD (Full length+N terminal) Rabbit pAb |
---|---|
Catalog No. | A10164 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 80-163 of mouse Cleaved GSDMD (NP_081236.1). |
---|---|
Sequence | SFKVSDVVDGNIQGRVMLSGMGEGKISGGAAVSDSSSASMNVCILRVTQKTWETMQHERHLQQPENKILQQLRSRGDDLFVVTE |
Gene ID | |
Swiss Prot | |
Synonyms | DF5L; M2-4; Dfna5l; GsdmD-1; Gsdmdc1; 1810036L03Rik; GSDMD (Full Length+N terminal) |
Calculated MW | 53kDa |
Observed MW | 29kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | THP-1 treated by TPA and LPS, 293T transfected with GSDMD-N, 293T transfected with GSDMD |
Cellular location | cytosol, extracellular region, extracellular space, NLRP3 inflammasome complex, nucleoplasm, plasma membrane |
Customer validation | (Human chronic myeloid leukemia cells, HeLa cells, N9) WB(Homo sapiens,Rattus norvegicus, Mus musculus, Homo sapiens, Rattus norvegicus) IHC(Mus musculus) IF(Homo sapiens, Rattus norvegicus, Mus musculus) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A10164? Please let us know so that we can cite the reference in this datasheet.