Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | GSDME (Full length+N terminal)Rabbit pAb |
---|---|
Catalog No. | A7432 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-270 of human GSDME (NP_004394.1). |
---|---|
Sequence | MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPD |
Gene ID | |
Swiss Prot | |
Synonyms | DFNA5; ICERE-1; GSDME |
Calculated MW | 55kDa |
Observed MW | 30kDa/55kDa/55kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry Immunofluorescence |
Positive samples | SH-SY5Y treated by Etopoisde, A549, SH-SY5Y, Mouse brain, Rat lung, Rat brain, Jurkat |
Cellular location | cytoplasm, cytosol, plasma membrane. |
Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus, Other, Anatinae) IHC(Mus musculus, Homo sapiens, Ctenopharyngodon idellus) IF(Rattus norvegicus) RT-qPCR(Mus musculus) WB(Ctenopharyngodon idellus) Other(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7432? Please let us know so that we can cite the reference in this datasheet.