Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using GSDME Rabbit pAb (A7432) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of lysates from Jurkat cells using GSDME Rabbit pAb (A7432) at 1:1000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Enhanced Kit (RM00021).
Exposure time: 60s.
Immunohistochemistry analysis of paraffin-embedded Human pulmonary tuberculosis using GSDME Rabbit pAb (A7432) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human pancreatic panniculitis using GSDME Rabbit pAb (A7432) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.
Immunofluorescence analysis of U2OS cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of NIH/3T3 cells using GSDME Rabbit pAb (A7432) at dilution of 1:50. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | GSDME (Full length+N terminal)Rabbit pAb |
|---|---|
| Catalog No. | A7432 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-270 of human GSDME (NP_004394.1). |
|---|---|
| Sequence | MFAKATRNFLREVDADGDLIAVSNLNDSDKLQLLSLVTKKKRFWCWQRPKYQFLSLTLGDVLIEDQFPSPVVVESDFVKYEGKFANHVSGTLETALGKVKLNLGGSSRVESQSSFGTLRKQEVDLQQLIRDSAERTINLRNPVLQQVLEGRNEVLCVLTQKITTMQKCVISEHMQVEEKCGGIVGIQTKTVQVSATEDGNVTKDSNVVLEIPAATTIAYGVIELYVKLDGQFEFCLLRGKQGGFENKKRIDSVYLDPLVFREFAFIDMPD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | DFNA5; ICERE-1; GSDME |
| Calculated MW | 55kDa |
| Observed MW | 30kDa/55kDa/55kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | SH-SY5Y treated by Etopoisde, A549, SH-SY5Y, Mouse brain, Rat lung, Rat brain, Jurkat |
| Cellular location | cytoplasm, cytosol, plasma membrane. |
| Customer validation | WB(Homo sapiens, Rattus norvegicus, Mus musculus, Other) IHC(Mus musculus, Homo sapiens, Ctenopharyngodon idellus) IF(Rattus norvegicus) RT-qPCR(Mus musculus) WB(Ctenopharyngodon idellus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7432? Please let us know so that we can cite the reference in this datasheet.
![[KO Validated] Cleaved Gasdermin E (N terminal) Rabbit mAb](https://img.abclonal.com/abclonal-manage/Catalog/A26197/A26197_1.jpg?t=1730362435)
