제품 > 항체 > 단일클론항체(mAb)

GSR Rabbit mAb (A4566)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using GSR Rabbit mAb (A4566) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	GSR Rabbit mAb
Catalog No.	A4566
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1034

Background

This gene encodes a member of the class-I pyridine nucleotide-disulfide oxidoreductase family. This enzyme is a homodimeric flavoprotein. It is a central enzyme of cellular antioxidant defense, and reduces oxidized glutathione disulfide (GSSG) to the sulfhydryl form GSH, which is an important cellular antioxidant. Rare mutations in this gene result in hereditary glutathione reductase deficiency. Multiple alternatively spliced transcript variants encoding different isoforms have been found.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 423-522 of human GSR (P00390).
Sequence	TVGLTEDEAIHKYGIENVKTYSTSFTPMYHAVTKRKTKCVMKMVCANKEEKVVGIHMQGLGCDEMLQGFAVAVKMGATKADFDNTVAIHPTSSEELVTLR
Gene ID
Swiss Prot
Synonyms	GR; GSRD; HEL-75; HEL-S-122m; GSR
Calculated MW	56kDa
Observed MW	56kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Hep G2, A549, K-562, Mouse liver, Mouse brain, Mouse kidney, Rat lung, Rat liver, Rat kidney
Cellular location	Cytoplasm, Mitochondrion.
Customer validation	(HeLa、T-47D、HepG2、RPMI-8226、MCF-7、U2-OS、PC-3)