GSTO2 Rabbit pAb (A14156)

Datasheet

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

ABclonal:Immunofluorescence - GSTO2 Rabbit pAb (A14156)

Immunofluorescence analysis of U2OS cells using GSTO2 antibody (A14156). Blue: DAPI for nuclear staining.

Overview

Product name	GSTO2 Rabbit pAb
Catalog No.	A14156
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

The protein encoded by this gene is an omega class glutathione S-transferase (GST). GSTs are involved in the metabolism of xenobiotics and carcinogens. Four transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 124-243 of human GSTO2 (NP_899062.1).
Sequence	PHLTKECLVALRCGRECTNLKAALRQEFSNLEEILEYQNTTFFGGTCISMIDYLLWPWFERLDVYGILDCVSHTPALRLWISAMKWDPTVCALLMDKSIFQGFLNLYFQNNPNAFDFGLC
Gene ID
Swiss Prot
Synonyms	GSTO 2-2; bA127L20.1
Calculated MW	28kDa
Observed MW

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Immunofluorescence
Positive samples
Cellular location	cytoplasm, cytosol, extracellular exosome