제품 > 항체 > 단일클론항체(mAb)

Glutaminase (GLS) Rabbit mAb (A23189)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates, using Glutaminase (GLS) Rabbit mAb (A23189) at 1:2000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

ABclonal:Immunofluorescence - Glutaminase (GLS) Rabbit mAb (A23189)

Immunofluorescence analysis of NIH/3T3 cells using Glutaminase (GLS) Rabbit mAb (A23189) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Glutaminase (GLS) Rabbit mAb
Catalog No.	A23189
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC59924

Background

This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 40-140 of human Glutaminase (GLS). (NP_055720.3).
Sequence	GGGRPAAGPAAAARLHPWWGGGGWPAEPLARGLSSSPSEILQELGKGSTHPQPGVSPPAAPAAPGPKDGPGETDAFGNSEGKELVASGENKIKQGLLPSLE
Gene ID
Swiss Prot
Synonyms	GAC; GAM; KGA; GLS1; AAD20; DEE71; GDPAG; CASGID; EIEE71; Glutaminase (GLS)
Calculated MW	73kDa
Observed MW	58kDa/65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T, Mouse ovary
Cellular location	Cytoplasm, Mitochondrion, cytosol
Customer validation	IHC(Mus musculus)