Review (1)Publication (3) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | Glutaminase (GLS) Rabbit pAb |
---|---|
Catalog No. | A3885 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 610-669 of human Glutaminase (Glutaminase (GLS)) (NP_055720.3). |
---|---|
Sequence | KVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL |
Gene ID | |
Swiss Prot | |
Synonyms | GAC; GAM; KGA; GLS1; AAD20; DEE71; GDPAG; CASGID; EIEE71 |
Calculated MW | 73kDa |
Observed MW | 65-73kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | U-251MG, NIH/3T3, Mouse brain, Rat kidney |
Cellular location | Cytoplasm, Mitochondrion, cytosol |
Customer validation | (MCF-7) WB(Mus musculus, Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A3885? Please let us know so that we can cite the reference in this datasheet.