제품 > 항체 > 단일클론항체(mAb)

Glutathione Synthetase (GSS) Rabbit mAb (A11557)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using Glutathione Synthetase (GSS) (GSS) Rabbit mAb (A11557) at 1：1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - Glutathione Synthetase (GSS) Rabbit mAb (A11557)

Immunofluorescence analysis of NIH-3T3 cells using Glutathione Synthetase (GSS) (GSS) Rabbit mAb (A11557) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

Review

Overview

Product name	Glutathione Synthetase (GSS) Rabbit mAb
Catalog No.	A11557
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0630

Background

Glutathione is important for a variety of biological functions, including protection of cells from oxidative damage by free radicals, detoxification of xenobiotics, and membrane transport. The protein encoded by this gene functions as a homodimer to catalyze the second step of glutathione biosynthesis, which is the ATP-dependent conversion of gamma-L-glutamyl-L-cysteine to glutathione. Defects in this gene are a cause of glutathione synthetase deficiency.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 350-450 of human Glutathione Synthetase (GSS) (P48637).
Sequence	AIAEALAAPSRFVLKPQREGGGNNLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLR
Gene ID
Swiss Prot
Synonyms	GSHS; HEL-S-64p; HEL-S-88n
Calculated MW	52kDa
Observed MW	52kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, 293T, HepG2, Mouse lung, Mouse liver, Mouse kidney, Rat lung, Rat liver, Rat kidney
Cellular location	cytosol, extracellular exosome
Customer validation	(HeLa、T-47D、HepG2、HL-60、RPMI-8226、MCF-7、U2-OS、PC-3、MOLT-4) WB(Homo sapiens)

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

Glutathione Synthetase (GSS) Rabbit mAb images

Western blot - Glutathione Synthetase (GSS) Rabbit mAb (A11557)

Immunofluorescence - Glutathione Synthetase (GSS) Rabbit mAb (A11557)

Immunofluorescence analysis of NIH-3T3 cells using Glutathione Synthetase (GSS) (GSS) Rabbit mAb (A11557) at dilution of 1:100 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.