Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of lysates from wild type (WT) and Glutathione Synthetase (Glutathione Synthetase (GSS)) knockout (KO) 293T cells, using [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 5s.
Immunofluorescence analysis of NIH/3T3 cells using [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
Immunofluorescence analysis of PC-12 cells using [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.
| Product name | [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb |
|---|---|
| Catalog No. | A14535 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 373-474 of human Glutathione Synthetase (Glutathione Synthetase (GSS)) (NP_000169.1). |
|---|---|
| Sequence | NLYGEEMVQALKQLKDSEERASYILMEKIEPEPFENCLLRPGSPARVVQCISELGIFGVYVRQEKTLVMNKHVGHLLRTKAIEHADGGVAAGVAVLDNPYPV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | GSHS; HEL-S-64p; HEL-S-88n; S) |
| Calculated MW | 52kDa |
| Observed MW | 52kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | 293T, SH-SY5Y, Mouse liver, Mouse kidney, Rat lung |
| Cellular location | cytosol, extracellular exosome |
| Customer validation | WB(Rattus norvegicus, Homo sapiens, Mus musculus) IF(Homo sapiens) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A14535? Please let us know so that we can cite the reference in this datasheet.
![ABclonal:Western blot - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A14535_Q4842_KO-WB_01.jpg?t=1709114433 "ABclonal:Western blot - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)")
![ABclonal:Immunofluorescence - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A14535_Q4842_IF_01.jpg?t=1709114433 "ABclonal:Immunofluorescence - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)")
![ABclonal:Immunofluorescence - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A14535_Q4842_IF_02.jpg?t=1709114433 "ABclonal:Immunofluorescence - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)")
![ABclonal:Immunofluorescence - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)](https://abclonal.oss-cn-hangzhou.aliyuncs.com/A14535_Q4842_IF_03.jpg?t=1709114433 "ABclonal:Immunofluorescence - [KO Validated] Glutathione Synthetase (GSS) Rabbit pAb (A14535)")
