Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | Granulin Rabbit mAb |
---|---|
Catalog No. | A20806 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC51125 |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 20-200 of human Granulin (NP_002078.1). |
---|---|
Sequence | CPDGQFCPVACCLDPGGASYSCCRPLLDKWPTTLSRHLGGPCQVDAHCSAGHSCIFTVSGTSSCCPFPEAVACGDGHHCCPRGFHCSADGRSCFQRSGNNSVGAIQCPDSQFECPDFSTCCVMVDGSWGCCPMPQASCCEDRVHCCPHGAFCDLVHTRCITPTGTHPLAKKLPAQRTNRAV |
Gene ID | |
Swiss Prot | |
Synonyms | GEP; GP88; PEPI; PGRN; CLN11; PCDGF; Granulin |
Calculated MW | 64kDa |
Observed MW | 65-75kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-431, HepG2, 293T |
Cellular location | Secreted |
Customer validation | IHC(Homo sapiens) |
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A20806? Please let us know so that we can cite the reference in this datasheet.