제품 > 항체 > 단일클론항체(mAb)

Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (A3687)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Guanylyl Cyclase beta 1 (GUCY1B3) (GUCY1B3) Rabbit mAb (A3687) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunohistochemistry - Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (A3687)

Immunohistochemistry analysis of paraffin-embedded Mouse brain tissue using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (A3687) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat brain tissue using Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (A3687) at a dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Tris-EDTA Buffer (pH 9.0) prior to IHC staining.

ABclonal:Immunofluorescence - Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb (A3687)

Immunofluorescence analysis of NIH-3T3 cells using Guanylyl Cyclase beta 1 (GUCY1B3) (GUCY1B3) Rabbit mAb (A3687) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Guanylyl Cyclase beta 1 (GUCY1B3) Rabbit mAb
Catalog No.	A3687
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2071

Background

This gene encodes the beta subunit of the soluble guanylate cyclase (sGC), which catalyzes the conversion of GTP (guanosine triphosphate) to cGMP (cyclic guanosine monophosphate). The encoded protein contains an HNOX domain, which serves as a receptor for ligands such as nitric oxide, oxygen and nitrovasodilator drugs. Alternative splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Guanylyl Cyclase beta 1 (GUCY1B3) (Q02153).
Sequence	MYGFVNHALELLVIRNYGPEVWEDIKKEAQLDEEGQFLVRIIYDDSKTYDLVAAASKVLNLNAGEILQMFGKMFFVFCQESGYDTILRVLGSNVREFLQN
Gene ID
Swiss Prot
Synonyms	GUCB3; GC-SB3; GUC1B3; GUCSB3; GUCY1B3; GC-S-beta-1; Guanylyl Cyclase beta 1 (GUCY1B3)
Calculated MW	71kDa
Observed MW	71kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IHC-P 1:200 - 1:800 IF/ICC 1:100 - 1:400 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	U-87MG, Mouse lung, Mouse brain, Mouse heart, Rat brain
Cellular location	Cytoplasm.