제품 > 항체 > 단일클론항체(mAb)

H2-Ab1 Rabbit mAb (A24650)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse

Western blot analysis of various lysates using H2-Ab1 Rabbit mAb (A24650) at 1:4000 dilution incubated overnight at 4℃.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 15s.

ABclonal:Immunohistochemistry - H2-Ab1 Rabbit mAb (A24650)

Immunohistochemistry analysis of paraffin-embedded Mouse spleen tissue using H2-Ab1 Rabbit mAb (A24650) at dilution of 1:300 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Buffer (pH 6.0) prior to IHC staining.

Overview

Product name	H2-Ab1 Rabbit mAb
Catalog No.	A24650
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC64051

Background

Enables several functions, including peptide antigen binding activity; protein antigen binding activity; and toxic substance binding activity. Involved in several processes, including B cell affinity maturation; cellular response to interferon-gamma; and positive regulation of T-helper 1 type immune response. Acts upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II and immune response. Located in Golgi apparatus; endosome; and external side of plasma membrane. Is integral component of membrane. Part of MHC class II protein complex. Is expressed in lung; metanephros; and thymus primordium. Orthologous to human HLA-DQB2 (major histocompatibility complex, class II, DQ beta 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 31-219 of mouse H2-Ab1（NP_996988.2）.
Sequence	ERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQ
Gene ID
Swiss Prot
Synonyms	IAb; Ia2; Ia-2; Abeta; H-2Ab; H2-Ab; Rmcs1; I-Abeta; H2-Ab1
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:2000 - 1:5000 IHC-P 1:100 - 1:500 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse thymus
Cellular location	cell surface, early endosome, external side of plasma membrane, Golgi apparatus, multivesicular body, plasma membrane.