제품 > 항체 > 다중클론항체(pAb)

H2-Ab1 Rabbit pAb (A18658)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of lysates from Mouse large intestine, using H2-Ab1 Rabbit pAb (A18658) at 1:500 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 20s.

ABclonal:Immunohistochemistry - H2-Ab1 Rabbit pAb (A18658)

Immunohistochemistry analysis of paraffin-embedded Mouse spleen using H2-Ab1 Rabbit pAb (A18658) at dilution of 1:50 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - H2-Ab1 Rabbit pAb (A18658)

Immunofluorescence analysis of NIH-3T3 cells using H2-Ab1 Rabbit pAb (A18658) at dilution of 1:100 (40x lens). Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	H2-Ab1 Rabbit pAb
Catalog No.	A18658
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables several functions, including peptide antigen binding activity; protein antigen binding activity; and toxic substance binding activity. Involved in several processes, including B cell affinity maturation; cellular response to interferon-gamma; and positive regulation of T-helper 1 type immune response. Acts upstream of or within antigen processing and presentation of exogenous peptide antigen via MHC class II and immune response. Located in Golgi apparatus; endosome; and external side of plasma membrane. Is integral component of membrane. Part of MHC class II protein complex. Is expressed in lung; metanephros; and thymus primordium. Orthologous to human HLA-DQB2 (major histocompatibility complex, class II, DQ beta 2).

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 30-219 of mouse H2-Ab1 (NP_996988.2).
Sequence	SERHFVYQFMGECYFTNGTQRIRYVTRYIYNREEYVRYDSDVGEHRAVTELGRPDAEYWNSQPEILERTRAELDTVCRHNYEGPETHTSLRRLEQPNVVISLSRTEALNHHNTLVCSVTDFYPAKIKVRWFRNGQEETVGVSSTQLIRNGDWTFQVLVMLEMTPRRGEVYTCHVEHPSLKSPITVEWRAQ
Gene ID
Swiss Prot
Synonyms	IAb; Ia2; Ia-2; Abeta; H-2Ab; H2-Ab; Rmcs1; I-Abeta; H2-Ab1
Calculated MW	30kDa
Observed MW	30kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IHC-P 1:50 - 1:200 IF/ICC 1:50 - 1:200 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	Mouse large intestine
Cellular location	cell surface, early endosome, external side of plasma membrane, Golgi apparatus, multivesicular body, plasma membrane.
Customer validation	IF(Mus musculus) WB(Rattus norvegicus, Macaca mulatta, Mus musculus)