제품 > 항체 > 다중클론항체(pAb)

HABP4 Rabbit pAb (A17644)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of various lysates using HABP4 Rabbit pAb (A17644) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

Overview

Product name	HABP4 Rabbit pAb
Catalog No.	A17644
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Enables SUMO binding activity. Involved in PML body organization; negative regulation of DNA binding activity; and positive regulation of gene expression. Located in several cellular components, including Golgi apparatus; cytoplasmic stress granule; and nuclear lumen.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HABP4 (NP_055097.2).
Sequence	QQQLQRKRRDEAAAAAGAGPRGGRSPAGASGHRAGAGGRRESQKERKSLPAPVAQRPDSPGGGLQAPGQKRTPRRGEQQGWNDSRGPEGMLERAERRSYRE
Gene ID
Swiss Prot
Synonyms	IHABP4; IHABP-4; Ki-1/57; SERBP1L; HABP4
Calculated MW	46kDa
Observed MW	46kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse brain, Mouse kidney, Rat kidney
Cellular location	Cajal body, cytoplasm, cytoplasmic stress granule, cytosol, extracellular region, Gemini of coiled bodies, nuclear membrane, nuclear speck, nucleolus, nucleus, sarcomere, sarcoplasm