제품 > 항체 > 다중클론항체(pAb)

HCoV-HKU1 Nucleoprotein Rabbit pAb (A20612)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:HCoV-HKU1

Western blot analysis of lysates from Human coronavirus (HCoV-HKU1) Nucleocapsid Protein (His Tag), using HCoV-HKU1 Nucleoprotein Rabbit pAb (A20612) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	HCoV-HKU1 Nucleoprotein Rabbit pAb
Catalog No.	A20612
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of coronavirus Nucleoprotein (YP_173242.1).
Sequence	WYRHSRRSFKTADGQQKQLLPRWYFYYLGTGPYANASYGESLEGVFWVANHQADTSTPSDVSSRDPTTQEAIPTRFPPGTILPQGYYVEGSGRSASNSRPG
Gene ID
Swiss Prot
Synonyms
Calculated MW	49kDa
Observed MW	50-60kDa

Applications

Reactivity	HCoV-HKU1
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Human coronavirus (HCoV-HKU1) Nucleocapsid Protein (His Tag)
Cellular location