제품 > 항체 > 단일클론항체(mAb)

HEC1/NDC80 Rabbit mAb (A2392)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates using HEC1/NDC80 Rabbit mAb (A2392) at 1：1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

Overview

Product name	HEC1/NDC80 Rabbit mAb
Catalog No.	A2392
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0741

Background

This gene encodes a component of the NDC80 kinetochore complex. The encoded protein consists of an N-terminal microtubule binding domain and a C-terminal coiled-coiled domain that interacts with other components of the complex. This protein functions to organize and stabilize microtubule-kinetochore interactions and is required for proper chromosome segregation.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 543-642 of human HEC1/NDC80 (O14777).
Sequence	ESTVNQGLSEAMNELDAVQREYQLVVQTTTEERRKVGNNLQRLLEMVATHVGSVEKHLEEQIAKVDREYEECMSEDLSENIKEIRDKYEKKATLIKSSEE
Gene ID
Swiss Prot
Synonyms	HEC; HEC1; TID3; KNTC2; HsHec1; hsNDC80; HEC1/NDC80
Calculated MW	74kDa
Observed MW	76kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, Jurkat
Cellular location	Chromosome, Nucleus, centromere, kinetochore.