제품 > 항체 > 다중클론항체(pAb)

HGS Rabbit pAb (A1790)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HGS Rabbit pAb (A1790) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunofluorescence - HGS Rabbit pAb (A1790)

Immunofluorescence analysis of U-2 OS cells using HGS Rabbit pAb (A1790) at dilution of 100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - HGS Rabbit pAb (A1790)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg HGS antibody (A1790). Western blot was performed from the immunoprecipitate using HGS antibody (A1790) at a dilution of 1:1000.

Overview

Product name	HGS Rabbit pAb
Catalog No.	A1790
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene regulates endosomal sorting and plays a critical role in the recycling and degradation of membrane receptors. The encoded protein sorts monoubiquitinated membrane proteins into the multivesicular body, targeting these proteins for lysosome-dependent degradation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 548-777 of human HGS (NP_004703.1).
Sequence	EQQKQTVQMRAQMPAFPLPYAQLQAMPAAGGVLYQPSGPASFPSTFSPAGSVEGSPMHGVYMSQPAPAAGPYPSMPSTAADPSMVSAYMYPAGATGAQAAPQAQAGPTASPAYSSYQPTPTAGYQNVASQAPQSLPAISQPPQSSTMGYMGSQSVSMGYQPYNMQNLMTTLPSQDASLPPQQPYIAGQQPMYQQMAPSGGPPQQQPPVAQQPQAQGPPAQGSEAQLISFD
Gene ID
Swiss Prot
Synonyms	HRS; HGS
Calculated MW	86kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	THP-1, OVCAR3, MCF7, HepG2, Mouse testis, Rat testis
Cellular location	Cytoplasm, Cytoplasmic side, Early endosome membrane, Endosome, Peripheral membrane protein, multivesicular body membrane
Customer validation	WB(Rattus norvegicus, Mus musculus, Homo sapiens) IP(Homo sapiens)