제품 > 항체 > 단일클론항체(mAb)

HK1 Rabbit mAb (A23524)

Datasheet

Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - HK1 Rabbit mAb (A23524)

Western blot analysis of various lysates, using [KO Validated] HK1 Rabbit mAb (A23524) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.

ABclonal:Immunofluorescence - HK1 Rabbit mAb (A23524)

Confocal imaging of HeLa cells using [KO Validated] HK1 Rabbit mAb (A23524, dilution 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product nameHK1 Rabbit mAb
Catalog No.A23524
Host speciesRabbit
Purification methodAffinity purification
IsotypeIgG
CloneNo.ARC51068
Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.
ImmunogenRecombinant fusion protein containing a sequence corresponding to amino acids 21-219 of human HK1 (NP_000179.2).
Sequence KIDKYLYAMRLSDETLIDIMTRFRKEMKNGLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPVGFTFSFPCQQSKIDEAILITWTKRFKASGVEGADVVKLLNKAIKKRGDYDANIVAVVNDTVGTMMTCGY
Gene ID
Swiss Prot
SynonymsHK; HKD; HKI; HXK1; NMSR; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; NEDVIBA; hexokinase
Calculated MW102kDa
Observed MW102kDa
ReactivityHuman, Mouse, Rat
Tested applicationsWBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition
Recommended dilution
  • WB 1:500 - 1:1000
  • IF/ICC 1:50 - 1:200
Storage bufferStore at -20℃. Avoid freeze / thaw cycles.
Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key applicationWestern blotting    Immunofluorescence    
Positive samples293T, Mouse brain
Cellular locationMitochondrion outer membrane

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

ABclonal:Western blot - HK1 Rabbit mAb (A23524)}

Western blot - HK1 Rabbit mAb (A23524)

Western blot analysis of various lysates, using [KO Validated] HK1 Rabbit mAb (A23524) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3s.
ABclonal:Immunofluorescence - HK1 Rabbit mAb (A23524)}

Immunofluorescence - HK1 Rabbit mAb (A23524)

Confocal imaging of HeLa cells using [KO Validated] HK1 Rabbit mAb (A23524, dilution 1:100) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) (Green). DAPI was used for nuclear staining (blue). Objective: 60x.

* For research use only. Not for therapeutic or diagnostic purposes.

항체 (3)

Secondary Antibodies (25)