제품 > 항체 > 단일클론항체(mAb)

[KO Validated] HK1 Rabbit mAb (A0533)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

ABclonal:Western blot - [KO Validated] HK1 Rabbit mAb (A0533)

Western blot analysis of lysates from wild type (WT) and HK1 knockout (KO) 293T cells, using [KO Validated] HK1 Rabbit mAb (A0533) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

Western blot analysis of various lysates using [KO Validated] HK1 Rabbit mAb (A0533) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.

ABclonal:Immunohistochemistry - [KO Validated] HK1 Rabbit mAb (A0533)

Immunohistochemistry analysis of paraffin-embedded Mouse kidney tissue using [KO Validated] HK1 Rabbit mAb (A0533) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using [KO Validated] HK1 Rabbit mAb (A0533) at dilution of 1:200 (40x lens). High pressure antigen retrieval performed with 0.01M Citrate Bufferr (pH 6.0) prior to IHC staining.

ABclonal:Immunofluorescence - [KO Validated] HK1 Rabbit mAb (A0533)

Confocal imaging of U-2 OS cells using [KO Validated] HK1 Rabbit mAb (A0533, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green). DAPI was used for nuclear staining (Blue). Objective: 100x.

Confocal imaging of paraffin-embedded Mouse kidney tissue using [KO Validated] HK1 Rabbit mAb (A0533, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500) (Red). DAPI was used for nuclear staining (Blue). Objective: 40x.Perform high pressure antigen retrieval with 0.01M citrate buffer (pH 6.0) prior to IF staining.

ABclonal:Immunoprecipitation - [KO Validated] HK1 Rabbit mAb (A0533)

Immunoprecipitation analysis of 600 μg extracts of Mouse brain cells using 3 μg [KO Validated] HK1 Rabbit mAb (A0533). Western blot was performed from the immunoprecipitate using HK1 (A0533) at a dilution of 1:1000.

Review

Overview

Product name	[KO Validated] HK1 Rabbit mAb
Catalog No.	A0533
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0256

Background

Hexokinases phosphorylate glucose to produce glucose-6-phosphate, the first step in most glucose metabolism pathways. This gene encodes a ubiquitous form of hexokinase which localizes to the outer membrane of mitochondria. Mutations in this gene have been associated with hemolytic anemia due to hexokinase deficiency. Alternative splicing of this gene results in several transcript variants which encode different isoforms, some of which are tissue-specific.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human Hexokinase 1 (P19367).
Sequence	GLSRDFNPTATVKMLPTFVRSIPDGSEKGDFIALDLGGSSFRILRVQVNHEKNQNVHMESEVYDTPENIVHGSGSQLFDHVAECLGDFMEKRKIKDKKLPV
Gene ID
Swiss Prot
Synonyms	HK; HKD; HKI; HXK1; NMSR; RP79; HMSNR; HK1-ta; HK1-tb; HK1-tc; NEDVIBA; hexokinase; K1
Calculated MW	102kDa
Observed MW	120kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IHC-P 1:200 - 1:800 IF/ICC 1:200 - 1:800 IP 0.5μg-4μg antibody for 400μg-600μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation
Positive samples	293T, MCF7, Mouse testis, Mouse brain, Rat testis, Rat brain
Cellular location	Mitochondrion outer membrane.
Customer validation	(293T、 HeLa 、MCF-7、MLOT-4 、 T-47D, 293T, Hela, MCF-7, MOLT-4, T47D) WB(Homo sapiens, Mus musculus)