Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human
Product name | HLA-DRB4 Rabbit mAb |
---|---|
Catalog No. | A0439 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC2505 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-DRB4 (P13762). |
---|---|
Sequence | TERVWNLIRYIYNQEEYARYNSDLGEYQAVTELGRPDAEYWNSQKDLLERRRAEVDTYCRYNYGVVESFTVQRRVQPKVTVYPSKTQPLQHHNLLVCSVNG |
Gene ID | |
Swiss Prot | |
Synonyms | DR4; DRB4; HLA-DRB; HLA-DR4B; HLA-DRB4 |
Calculated MW | 30kDa |
Observed MW | 30kDa |
Reactivity | Human |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | Raji |
Cellular location | Cell membrane, Endoplasmic reticulum membrane, Endosome membrane, Golgi apparatus, Late endosome membrane, Lysosome membrane, Single-pass type I membrane protein, Trans-Golgi network membrane |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.