제품 > 항체 > 단일클론항체(mAb)

HLA-G Rabbit mAb (A24425)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of extracts of wild type (WT) and 293T cells transfected with HLA-G using HLA-G Rabbit mAb (A24425) at 1:10000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 0.3s.

ABclonal:Immunofluorescence - HLA-G Rabbit mAb (A24425)

Confocal imaging of 293F-HLA-G and 293F cells cells using HLA-G Rabbit mAb (A24425, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

Overview

Product name	HLA-G Rabbit mAb
Catalog No.	A24425
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC63292

Background

HLA-G belongs to the HLA class I heavy chain paralogues. This class I molecule is a heterodimer consisting of a heavy chain and a light chain (beta-2 microglobulin). The heavy chain is anchored in the membrane. HLA-G is expressed on fetal derived placental cells. The heavy chain is approximately 45 kDa and its gene contains 8 exons. Exon one encodes the leader peptide, exons 2 and 3 encode the alpha1 and alpha2 domain, which both bind the peptide, exon 4 encodes the alpha3 domain, exon 5 encodes the transmembrane region, and exon 6 encodes the cytoplasmic tail.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 50-150 of human HLA-G (NP_002118.1).
Sequence	GYVDDTQFVRFDSDSACPRMEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGSDGRLLRGYEQYAYDGKDYLAL
Gene ID
Swiss Prot
Synonyms	MHC-G; HLA-G
Calculated MW	38kDa
Observed MW	30-40kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:10000 - 1:60000 IF/ICC 1:200 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T transfected with HLA-G
Cellular location	Membrane, Single-pass type I membrane protein.

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

HLA-G Rabbit mAb images

Western blot - HLA-G Rabbit mAb (A24425)

Immunofluorescence - HLA-G Rabbit mAb (A24425)

Confocal imaging of 293F-HLA-G and 293F cells cells using HLA-G Rabbit mAb (A24425, dilution 1:200)(Red). DAPI was used for nuclear staining (blue). Objective: 100x.

* For research use only. Not for therapeutic or diagnostic purposes.