제품 > 항체 > 다중클론항체(pAb)

HMGA1 Rabbit pAb (A1635)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of lysates from 293T cells, using HMGA1 Rabbit pAb (A1635) at 1:3000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 90s.

ABclonal:Immunohistochemistry - HMGA1 Rabbit pAb (A1635)

Immunohistochemistry analysis of paraffin-embedded human stomach using HMGA1 Rabbit pAb (A1635) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	HMGA1 Rabbit pAb
Catalog No.	A1635
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a chromatin-associated protein involved in the regulation of gene transcription, integration of retroviruses into chromosomes, and the metastatic progression of cancer cells. The encoded protein preferentially binds to the minor groove of AT-rich regions in double-stranded DNA. Multiple transcript variants encoding different isoforms have been found for this gene. Pseudogenes of this gene have been identified on multiple chromosomes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGA1 (NP_665908.1).
Sequence	MSESSSKSSQPLASKQEKDGTEKRGRGRPRKQPPVSPGTALVGSQKEPSEVPTPKRPRGRPKGSKNKGAAKTRKTTTTPGRKPRGRPKKLEKEEEEGISQ
Gene ID
Swiss Prot
Synonyms	HMG-R; HMGIY; HMGA1A; HMGA1
Calculated MW	12kDa
Observed MW	20kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	293T
Cellular location	Chromosome, Nucleus
Customer validation	WB(Mus musculus) IHC(Homo sapiens) WB(Homo sapiens)