제품 > 항체 > 다중클론항체(pAb)

HMGN1 Rabbit pAb (A6155)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse

Western blot analysis of extracts of various cell lines, using HMGN1 antibody (A6155) at 1:1000 dilution._Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution._Lysates/proteins: 25μg per lane._Blocking buffer: 3% nonfat dry milk in TBST._Detection: ECL Enhanced Kit (RM00021)._Exposure time: 30s.

ABclonal:Immunofluorescence - HMGN1 Rabbit pAb (A6155)

Immunofluorescence analysis of HeLa cells using HMGN1 antibody (A6155) at dilution of 1:100. Blue: DAPI for nuclear staining.

Overview

Product name	HMGN1 Rabbit pAb
Catalog No.	A6155
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene binds nucleosomal DNA and is associated with transcriptionally active chromatin. Along with a similar protein, HMG17, the encoded protein may help maintain an open chromatin configuration around transcribable genes.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HMGN1 (NP_004956.5).
Sequence	MPKRKVSSAEGAAKEEPKRRSARLSAKPPAKVEAKPKKAAAKDKSSDKKVQTKGKRGAKGKQAEVANQETKEDLPAENGETKTEESPASDEAGEKEAKSD
Gene ID
Swiss Prot
Synonyms	HMG14
Calculated MW	11kDa
Observed MW	17kDa

Applications

Reactivity	Human, Mouse
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IF/ICC 1:50 - 1:100
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	HeLa, HepG2, Mouse kidney
Cellular location	Cytoplasm, Nucleus