제품 > 항체 > 단일클론항체(mAb)

HNF3β/FOXA2 Rabbit mAb (A19053)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Rat

Western blot analysis of various lysates using HNF3β/FOXA2 Rabbit mAb (A19053) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - HNF3β/FOXA2 Rabbit mAb (A19053)

Confocal imaging of Hep G2 cells using HNF3β/FOXA2 Rabbit mAb (A19053, dilution 1:100) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red).The cells were counterstained with α-Tubulin Mouse mAb (AC012, dilution 1:400) followed by incubation with ABflo® 488-conjugated Goat Anti-Mouse IgG (H+L) Ab (AS076, dilution 1:500) (Green).DAPI was used for nuclear staining (Blue). Objective: 100x.

ABclonal:Immunoprecipitation - HNF3β/FOXA2 Rabbit mAb (A19053)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg HNF3β/FOXA2 antibody (A19053). Western blot was performed from the immunoprecipitate using HNF3β/FOXA2 antibody (A19053) at a dilution of 1:1000.

Overview

Product name	HNF3β/FOXA2 Rabbit mAb
Catalog No.	A19053
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0391

Background

This gene encodes a member of the forkhead class of DNA-binding proteins. These hepatocyte nuclear factors are transcriptional activators for liver-specific genes such as albumin and transthyretin, and they also interact with chromatin. Similar family members in mice have roles in the regulation of metabolism and in the differentiation of the pancreas and liver. This gene has been linked to sporadic cases of maturity-onset diabetes of the young. Transcript variants encoding different isoforms have been identified for this gene.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human HNF3β/FOXA2 (Q9Y261).
Sequence	MLGAVKMEGHEPSDWSSYYAEPEGYSSVSNMNAGLGMNGMNTYMSMSAAAMGSGSGNMSAGSMNMSSYVGAGMSPSLAGMSPGAGAMAGMGGSAGAAGVA
Gene ID
Swiss Prot
Synonyms	HNF3B; TCF3B; HNF-3-beta; HNF3β/FOXA2
Calculated MW	48kDa
Observed MW	52kDa

Applications

Reactivity	Human, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:2000 IF/ICC 1:100 - 1:800 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	HepG2, Rat lung
Cellular location	Cytoplasm, Nucleus.
Customer validation	IF(Homo sapiens, Mus musculus) WB(Homo sapiens)