Review (1)Publications (13) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse
Product name | HSD3B2 Rabbit pAb |
---|---|
Catalog No. | A1823 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 1-287 of human HSD3B2 (NP_000189.1). |
---|---|
Sequence | MGWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQNRTKLTVLEGDILDEPFLKRACQDVSVVIHTACIIDVFGVTHRESIMNVNVKGTQLLLEACVQASVPVFIYTSSIEVAGPNSYKEIIQNGHEEEPLENTWPTPYPYSKKLAEKAVLAANGWNLKNGDTLYTCALRPTYIYGEGGPFLSASINEALNNNGILSSVGKFSTVNPVYVGNVAWAHILALRALRDPKKAPSVRGQFYYISDDTPHQSYDNLNYILSKEFGLRLDSRWSLPL |
Gene ID | |
Swiss Prot | |
Synonyms | HSDB; HSD3B; SDR11E2; HSD3B2 |
Calculated MW | 42kDa |
Observed MW | 42kDa |
Reactivity | Human, Mouse |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | 293T transfected with HSD3B2 |
Cellular location | Endoplasmic reticulum membrane, Mitochondrion membrane, Single-pass membrane protein. |
Customer validation | (Monopterus testis) WB(Homo sapiens, Mus musculus, Rattus norvegicus, Sus domesticus, Capra hircus, Gallus gallus) IHC(Mus musculus, Capra hircus) IHC(Capra hircus) mIHC(Capra hircus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A1823? Please let us know so that we can cite the reference in this datasheet.