Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of extracts of various cell lines, using HSPA2 antibody (A7902) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 60s.
Immunofluorescence analysis of L929 cells using HSPA2 antibody (A7902) at dilution of 1:100. Blue: DAPI for nuclear staining.
| Product name | HSPA2 Rabbit pAb |
|---|---|
| Catalog No. | A7902 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 400-639 of human HSPA2 (NP_068814.2). |
|---|---|
| Sequence | TPLSLGIETAGGVMTPLIKRNTTIPTKQTQTFTTYSDNQSSVLVQVYEGERAMTKDNNLLGKFDLTGIPPAPRGVPQIEVTFDIDANGILNVTAADKSTGKENKITITNDKGRLSKDDIDRMVQEAERYKSEDEANRDRVAAKNALESYTYNIKQTVEDEKLRGKISEQDKNKILDKCQEVINWLDRNQMAEKDEYEHKQKELERVCNPIISKLYQGGPGGGSGGGGSGASGGPTIEEVD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | HSP70-2; HSP70-3 |
| Calculated MW | 70kDa |
| Observed MW | 75kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunofluorescence |
| Positive samples | MCF7, A-549, SKOV3, HeLa, A-431, Mouse brain, Mouse testis, Rat brain, Rat kidney |
| Cellular location | blood microparticle, cell surface, cytoplasm, cytosol, extracellular exosome, male germ cell nucleus, meiotic spindle, nucleus, plasma membrane |
| Customer validation | WB(Anatinae) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A7902? Please let us know so that we can cite the reference in this datasheet.
