제품 > 항체 > 단일클론항체(mAb)

HSPA4 Rabbit mAb (A19705)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using HSPA4 Rabbit mAb (A19705) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - HSPA4 Rabbit mAb (A19705)

Immunohistochemistry analysis of paraffin-embedded human liver cancer using HSPA4 Rabbit mAb (A19705) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded rat liver using HSPA4 Rabbit mAb (A19705) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse spinal cord using HSPA4 Rabbit mAb (A19705) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.

Immunohistochemistry analysis of HSPA4 in paraffin-embedded human thyroid cancer tissue using HSPA4 Rabbit mAb (A19705) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HSPA4 in paraffin-embedded mouse intestin tissue using HSPA4 Rabbit mAb (A19705) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of HSPA4 in paraffin-embedded Human lung adenocarcinoma tissue using HSPA4 Rabbit mAb (A19705) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	HSPA4 Rabbit mAb
Catalog No.	A19705
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC2237

Background

Predicted to enable ATP binding activity. Involved in chaperone-mediated protein complex assembly and protein insertion into mitochondrial outer membrane. Located in cytosol and extracellular exosome. Implicated in Chagas disease. Biomarker of chronic obstructive pulmonary disease; rheumatoid arthritis; type 2 diabetes mellitus; and ulcerative colitis.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 700-800 of human HSPA4 (P34932).
Sequence	EELGKQIQQYMKIISSFKNKEDQYDHLDAADMTKVEKSTNEAMEWMNNKLNLQNKQSLTMDPVVKSKEIEAKIKELTSTCSPIISKPKPKVEPPKEEQKNA
Gene ID
Swiss Prot
Synonyms	RY; APG-2; HSPH2; hsp70; hsp70RY; HEL-S-5a; HS24/P52; HSPA4
Calculated MW	94kDa
Observed MW	110kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, 293T, NIH/3T3, K-562, C6, Mouse testis
Cellular location	Cytosol, Extracellular exosome, Mitochondrion, Nucleus
Customer validation	WB(Homo sapiens)