Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Western blot analysis of various lysates using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.
Immunohistochemistry analysis of paraffin-embedded Rat brain using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human colon using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human placenta using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Mouse kidney using HSPE1/HSP10/HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM Tris/EDTA buffer pH 9.0 before commencing with IHC staining protocol.
Immunohistochemistry analysis of paraffin-embedded Human thyroid cancer tissue using HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Human liver tissue using HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Mouse colon tissue using HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Immunohistochemistry analysis of paraffin-embedded Rat kidney tissue using HSPE1/HSP10/CPN10 Rabbit mAb (A5580) at a dilution of 1:400 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
| Product name | HSPE1/HSP10/CPN10 Rabbit mAb |
|---|---|
| Catalog No. | A5580 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC1411 |
| Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 50-150 of human HSPE1/HSP10/CPN10 (P61604). |
|---|---|
| Sequence | GSGSKGKGGEIQPVSVKVGDKVLLPEYGGTKVVLDDKDYFLFRDGDILGKYVD |
| Gene ID | |
| Swiss Prot | |
| Synonyms | EPF; CPN10; GROES; HSP10; HSPE1/HSP10/CPN10 |
| Calculated MW | 11kDa |
| Observed MW | 11kDa |
| Reactivity | Human, Mouse, Rat |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence |
| Positive samples | MCF7, C6, U-251MG, Neuro-2a, Rat kidney |
| Cellular location | Mitochondrion matrix |
| Customer validation | WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A5580? Please let us know so that we can cite the reference in this datasheet.
