제품 > 항체 > 단일클론항체(mAb)

HTRA2 Rabbit mAb (A3904)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of extracts of various cell lines, using HTRA2 Rabbit mAb (A3904) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

Review

Overview

Product name	HTRA2 Rabbit mAb
Catalog No.	A3904
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0864

Background

This gene encodes a serine protease. The protein has been localized in the endoplasmic reticulum and interacts with an alternatively spliced form of mitogen-activated protein kinase 14. The protein has also been localized to the mitochondria with release to the cytosol following apoptotic stimulus. The protein is thought to induce apoptosis by binding the apoptosis inhibitory protein baculoviral IAP repeat-containing 4. Nuclear localization of this protein has also been observed. Alternate splicing of this gene results in multiple transcript variants encoding different isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 100-200 of human HTRA2 (O43464).
Sequence	GTRSRAWLAVALGAGGAVLLLLWGGGRGPPAVLAAVPSPPPASPRSQYNFIADVVEKTAPAVVYIEILDRHPFLGREVPISNGSGFVVAADGLIVTNAHVV
Gene ID
Swiss Prot
Synonyms	OMI; MGCA8; PARK13; PRSS25
Calculated MW	49kDa
Observed MW	36kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	HeLa, 293T, SH-SY5Y, Mouse liver, Mouse brain, Mouse kidney, Rat brain, Rat kidney
Cellular location	Mitochondrion intermembrane space, Mitochondrion membrane, Single-pass membrane protein
Customer validation	(293T、Hela、HepG2、RPMI-8226、PC-3、A549、MOLT-4、K-562) IHC(Mus musculus)