Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Mouse, Rat
Product name | Histone H1t Rabbit pAb |
---|---|
Catalog No. | A18597 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 110-209 of mouse Histone H1t (NP_034507.2). |
---|---|
Sequence | LSKKAASGNDKGKGKKSASAKAKKMGLPRASRSPKSSKTKAVKKPKATPTKASGSGRKTKGAKGVQQRKSPAKARAANPNSGKAKMVMQKTDLRKAAGRK |
Gene ID | |
Swiss Prot | |
Synonyms | H1t; H1-6; H1.6; H1ft; Hist1h1t; Histone H1t |
Calculated MW | 22kDa |
Observed MW | 30kDa |
Reactivity | Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Mouse testis, Rat testis |
Cellular location | condensed nuclear chromosome, nucleus |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.