Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat, Other (Wide Range Predicted)
Western blot analysis of lysates from wild type (WT) and 293F cells transfected with Histone H2B (testis specific) using Histone H2B (testis specific) Rabbit mAb (A24166) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.
Western blot analysis of various lysates using Histone H2B (testis specific) Rabbit mAb (A24166) at 1:5000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25 μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Negative control (NC): Mouse brain, Rat brain.
Exposure time: 90s.
Immunohistochemistry analysis of paraffin-embedded Human testis tissue using Histone H2B (testis specific) Rabbit mAb (A24166) at a dilution of 1:1000 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.
Confocal imaging of paraffin-embedded Mouse testis using Histone H2B (testis specific) Rabbit mAb (A24166, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red). DAPI was used for nuclear staining (Blue).Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Confocal imaging of paraffin-embedded Human testis using Histone H2B (testis specific) Rabbit mAb (A24166, dilution 1:200) followed by a further incubation with Cy3 Goat Anti-Rabbit IgG (H+L) (AS007, dilution 1:500)(Red). DAPI was used for nuclear staining (Blue).Objective: 40x. Perform high pressure antigen retrieval with 0.01 M citrate buffer (pH 6.0) prior to IF staining.
Immunoprecipitation of Histone H2B (testis specific) from 600 µg extracts of Rat testis tissue was performed using 2 µg of Histone H2B (testis specific) Rabbit mAb (A24166). Rabbit IgG isotype control (AC042) was used to precipitate the Control IgG sample. IP samples were eluted with 1X non-reducing Laemmli Buffer. The Input lane represents 10% of the total input. Western blot analysis of immunoprecipitates was conducted using Histone H2B (testis specific) Rabbit mAb (A24166) at a dilution of 1:1000.
Chromatin immunoprecipitation was performed with cross-linked chromatin from mouse testis, using Histone H2B(testis specific) Rabbit mAb (A24166) and rabbit IgG(AC042) . The amount of immunoprecipitated DNA was checked by quantitative PCR. Histogram compares the ratio of the immunoprecipitated DNA versus the input.
| Product name | Histone H2B (testis specific) Rabbit mAb |
|---|---|
| Catalog No. | A24166 |
| Host species | Rabbit |
| Purification method | Affinity purification |
| Isotype | IgG |
| CloneNo. | ARC63457 |
| Immunogen | A synthetic peptide corresponding to a sequence within amino acids 1-100 of human Histone H2B (testis specific) (NP_733759.1). |
|---|---|
| Sequence | MPEVSSKGATISKKGFKKAVVKTQKKEGKKRKRTRKESYSIYIYKVLKQVHPDTGISSKAMSIMNSFVTDIFERIASEASRLAHYSKRSTISSREIQTAV |
| Gene ID | |
| Swiss Prot | |
| Synonyms | STBP; TH2B; H2BFU; TSH2B; hTSH2B; TSH2B.1; HIST1H2BA; bA317E16.3; Histone H2B (testis specific)? |
| Calculated MW | 14kDa |
| Observed MW | 20kDa/17kDa/17kDa |
| Reactivity | Human, Mouse, Rat, Other (Wide Range Predicted) |
|---|---|
| Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
| Recommended dilution |
|
| Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
| Key application | Western blotting Immunohistochemistry Immunofluorescence Immunoprecipitation |
| Positive samples | 293F transfected with Histone H2B (testis specific) (Human), Mouse testis, Rat testis, Rat testis |
| Cellular location | Chromosome, Nucleus. |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
