제품 > 항체 > 다중클론항체(pAb)

Human Thioredoxin Reductase 1/TRXR1 Rabbit pAb (A16631)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 90s.

ABclonal:Immunohistochemistry - Human Thioredoxin Reductase 1/TRXR1 Rabbit pAb (A16631)

Immunohistochemistry analysis of paraffin-embedded Human placenta using Thioredoxin reductase 1 (Thioredoxin reductase 1 (TXNRD1 ) ) antibody (A16631) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

Immunohistochemistry analysis of paraffin-embedded Mouse testis using Thioredoxin reductase 1 (Thioredoxin reductase 1 (TXNRD1 ) ) antibody (A16631) at dilution of 1:100 (40x lens). Microwave antigen retrieval performed with 0.01M PBS Buffer (pH 7.2) prior to IHC staining.

ABclonal:Immunofluorescence - Human Thioredoxin Reductase 1/TRXR1 Rabbit pAb (A16631)

Immunofluorescence analysis of C6 cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of L929 cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of U-2 OS cells using Thioredoxin reductase 1 (TXNRD1 ) Rabbit pAb (A16631) at dilution of 1:100. Secondary antibody: Cy3-conjugated Goat anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Overview

Product name	Human Thioredoxin Reductase 1/TRXR1 Rabbit pAb
Catalog No.	A16631
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 410-490 of human Thioredoxin reductase 1 (TXNRD1) (NP_001087240.1).
Sequence	EAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV
Gene ID
Swiss Prot
Synonyms	TR; TR1; TXNR; TRXR1; GRIM-12; Thioredoxin reductase 1 (TXNRD1 )
Calculated MW	71kDa
Observed MW	65kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000 IHC-P 1:50 - 1:100 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry Immunofluorescence
Positive samples	HepG2, BxPC-3, Mouse heart
Cellular location	cytosol, extracellular exosome, fibrillar center, mitochondrion, nucleoplasm.
Customer validation	WB(Gallus gallus, Homo sapiens)