Review (1)Publication (1) Datasheet
Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IDH1 Rabbit mAb |
---|---|
Catalog No. | A5106 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
CloneNo. | ARC54138 |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 100-200 of human IDH1 (NP_005887.2). |
---|---|
Sequence | RNILGGTVFREAIICKNIPRLVSGWVKPIIIGRHAYGDQYRATDFVVPGPGKVEITYTPSDGTQKVTYLVHNFEEGGGVAMGMYNQDKSIEDFAHSSFQMA |
Gene ID | |
Swiss Prot | |
Synonyms | IDH; IDP; IDCD; IDPC; PICD; HEL-216; HEL-S-26; IDH1 |
Calculated MW | 47kDa |
Observed MW | 46kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3. |
Key application | Western blotting Immunofluorescence |
Positive samples | Hep G2, MCF7, 293F, NIH/3T3, C2C12 |
Cellular location | Cytoplasm, Peroxisome. |
Customer validation | (HeLa、NCL-H460、U-87mg、MCF-7、HepG2) WB(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Please submit reviews to your technical sales specialist directly. Alternatively, email us at info@abclonal.co.kr
Publishing research using A5106? Please let us know so that we can cite the reference in this datasheet.