Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IGF1 Rabbit pAb |
---|---|
Catalog No. | A11985 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | A synthetic peptide corresponding to a sequence within amino acids 50-150 of human IGF1 (NP_000609.1). |
---|---|
Sequence | PETLCGAELVDALQFVCGDRGFYFNKPTGYGSSSRRAPQTGIVDECCFRSCDLRRLEMYCAPLKPAKSARSVRAQRHTDMPKTQKEVHLKNASRGSAGNKN |
Gene ID | |
Swiss Prot | |
Synonyms | IGF; MGF; IGFI; IGF-I; IGF1 |
Calculated MW | 22kDa |
Observed MW | 18kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.09% Sodium azide, 50% glycerol, pH7.3. |
Key application | Western blotting Immunohistochemistry |
Positive samples | U-87MG, SKOV3, HeLa, Mouse liver, Mouse testis, Rat testis |
Cellular location | Secreted. |
Customer validation | WB(Mus musculus, Sus scrofa, Homo sapiens, Ctenopharyngodon idellus, Pampus argenteus, Oryctolagus cuniculus, Mus musculus, Other, Neovison vison) IF(Mus musculus) |
To download a Certificate of Compliance, please enter your Lot number below:
Lot number
* For research use only. Not for therapeutic or diagnostic purposes.
Publishing research using A11985? Please let us know so that we can cite the reference in this datasheet.