Tested applications:WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibitionReactivity:Human, Mouse, Rat
Product name | IL1RAPL1 Rabbit pAb |
---|---|
Catalog No. | A3378 |
Host species | Rabbit |
Purification method | Affinity purification |
Isotype | IgG |
Immunogen | Recombinant fusion protein containing a sequence corresponding to amino acids 130-210 of human IL1RAPL1 (NP_055086.1). |
---|---|
Sequence | SISLTVGENDTGLCYNSKMKYFEKAELSKSKEISCRDIEDFLLPTREPEILWYKECRTKTWRPSIVFKRDTLLIREVREDD |
Gene ID | |
Swiss Prot | |
Synonyms | IL1R8; MRX10; MRX21; MRX34; OPHN4; IL1RAPL; TIGIRR-2; IL1RAPL-1; IL-1RAPL-1; IL-1-RAPL-1; IL1RAPL1 |
Calculated MW | 80kDa |
Observed MW | 90kDa |
Reactivity | Human, Mouse, Rat |
---|---|
Tested applications | WBIHC-PIF/ICCIPChIPChIP-seqRIPFCFC(Intra)ELISAMeDIPNucleotide ArrayDBFACSCoIPCUT&TagmeRIPInhibition |
Recommended dilution |
|
Storage buffer | Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3. |
Key application | Western blotting |
Positive samples | A-431, Mouse brain, Mouse heart, Rat brain, Rat heart |
Cellular location | Cell membrane, Cell projection, Cytoplasm, Single-pass type I membrane protein, axon, dendrite |
* For research use only. Not for therapeutic or diagnostic purposes.