제품 > 항체 > 단일클론항체(mAb)

IL1RA Rabbit mAb (A11103)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using IL1RA Rabbit mAb (A11103) at 1:1000 dilution.
Secondary antibody: HRP-conjugated Goat anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunofluorescence - IL1RA Rabbit mAb (A11103)

Confocal imaging of human skin using IL1RA Rabbit mAb (A11103, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Confocal imaging of mouse tail ear using IL1RA Rabbit mAb (A11103, dilution 1:100)(Red). DAPI was used for nuclear staining (blue). Objective: 60x.

Overview

Product name	IL1RA Rabbit mAb
Catalog No.	A11103
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC0524

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. This protein inhibits the activities of interleukin 1, alpha (IL1A) and interleukin 1, beta (IL1B), and modulates a variety of interleukin 1 related immune and inflammatory responses, particularly in the acute phase of infection and inflammation. This gene and five other closely related cytokine genes form a gene cluster spanning approximately 400 kb on chromosome 2. A polymorphism of this gene is reported to be associated with increased risk of osteoporotic fractures and gastric cancer. Several alternatively spliced transcript variants encoding distinct isoforms have been reported.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 100-177 of human IL1RA (NP_776214.1)
Sequence	ETRLQLEAVNITDLSENRKQDKRFAFIRSDSGPTTSFESAACPGWFLCTAMEADQPVSLTNMPDEGVMVTKFYFQEDE
Gene ID
Swiss Prot
Synonyms	DIRA; IRAP; IL1F3; IL1RA; MVCD4; IL-1RN; IL-1ra; IL-1ra3; ICIL-1RA
Calculated MW	20kDa
Observed MW	22kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:6000 IF/ICC 1:100 - 1:800 ELISA Recommended starting concentration is 1 μg/mL. Please optimize the concentration based on your specific assay requirements.
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	TE-1, A-431, NIH/3T3, SW480, Mouse lung, Mouse liver, Rat large intestine, Rat lung
Cellular location	Cytoplasm, Secreted.