제품 > 항체 > 단일클론항체(mAb)

IL-36 Gamma Rabbit mAb (A23961)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human

Western blot analysis of various lysates, using IL-36 Gamma Rabbit mAb (A23961) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25ug per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 10s.

ABclonal:Immunofluorescence - IL-36 Gamma Rabbit mAb (A23961)

Immunofluorescence analysis of 293F-IL36G and 293F cells using IL-36 Gamma Rabbit mAb (A23961) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

Overview

Product name	IL-36 Gamma Rabbit mAb
Catalog No.	A23961
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC62706

Background

The protein encoded by this gene is a member of the interleukin 1 cytokine family. The activity of this cytokine is mediated by interleukin 1 receptor-like 2 (IL1RL2/IL1R-rp2), and is specifically inhibited by interleukin 1 family, member 5 (IL1F5/IL-1 delta). Interferon-gamma, tumor necrosis factor-alpha and interleukin 1, beta (IL1B) are reported to stimulate the expression of this cytokine in keratinocytes. The expression of this cytokine in keratinocytes can also be induced by a contact hypersensitivity reaction or herpes simplex virus infection. This gene and eight other interleukin 1 family genes form a cytokine gene cluster on chromosome 2. Two alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 18-169 of human IL-36 Gamma (NP_062564.1).
Sequence	SMCKPITGTINDLNQQVWTLQGQNLVAVPRSDSVTPVTVAVITCKYPEALEQGRGDPIYLGIQNPEMCLYCEKVGEQPTLQLKEQKIMDLYGQPEPVKPFLFYRAKTGRTSTLESVAFPDWFIASSKRDQPIILTSELGKSYNTAFELNIND
Gene ID
Swiss Prot
Synonyms	IL36G; IL-1F9; IL-1H1; IL-1RP2; IL1E; IL1F9; IL1H1; IL1RP2; interleukin-36 gamma
Calculated MW	14kDa/18kDa
Observed MW	19kDa

Applications

Reactivity	Human
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.05% proclin300, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence
Positive samples	293T-IL-36 Gamma-Flag-N
Cellular location	Cytoplasm, secreted

Documents

Certificate of Compliance

To download a Certificate of Compliance, please enter your Lot number below:

Lot number

Research Area

연구면역학 & 염증사이토카인인터루킨

IL-36 Gamma Rabbit mAb images

Western blot - IL-36 Gamma Rabbit mAb (A23961)

Immunofluorescence - IL-36 Gamma Rabbit mAb (A23961)

Immunofluorescence analysis of 293F-IL36G and 293F cells using IL-36 Gamma Rabbit mAb (A23961) at dilution of 1:200 (40x lens). Blue: DAPI for nuclear staining.

* For research use only. Not for therapeutic or diagnostic purposes.