제품 > 항체 > 단일클론항체(mAb)

ILF3 Rabbit mAb (A8186)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using ILF3 Rabbit mAb (A8186) at 1:3000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 1s.

ABclonal:Immunohistochemistry - ILF3 Rabbit mAb (A8186)

Immunohistochemistry analysis of ILF3 in paraffin-embedded human colon carcinoma tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded human colon tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded human cervix cancer tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded human thyroid cancer tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse lung tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse testis tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded rat colon tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse colon tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded rat liver tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded human liver tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Immunohistochemistry analysis of ILF3 in paraffin-embedded mouse brain tissue using ILF3 Rabbit mAb (A8186) at a dilution of 1:200 (40x lens). High pressure antigen retrieval was performed with 0.01 M citrate buffer (pH 6.0) prior to IHC staining.

Overview

Product name	ILF3 Rabbit mAb
Catalog No.	A8186
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1438

Background

This gene encodes a double-stranded RNA (dsRNA) binding protein that complexes with other proteins, dsRNAs, small noncoding RNAs, and mRNAs to regulate gene expression and stabilize mRNAs. This protein (NF90, ILF3) forms a heterodimer with a 45 kDa transcription factor (NF45, ILF2) required for T-cell expression of interleukin 2. This complex has been shown to affect the redistribution of nuclear mRNA to the cytoplasm. Knockdown of NF45 or NF90 protein retards cell growth, possibly by inhibition of mRNA stabilization. In contrast, an isoform (NF110) of this gene that is predominantly restricted to the nucleus has only minor effects on cell growth when its levels are reduced. Alternative splicing results in multiple transcript variants encoding distinct isoforms.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 1-100 of human ILF3 (Q12906).
Sequence	MRPMRIFVNDDRHVMAKHSSVYPTQEELEAVQNMVSHTERALKAVSDWIDEQEKGSSEQAESDNMDVPPEDDSKEGAGEQKTEHMTRTLRGVMRVGLVAK
Gene ID
Swiss Prot
Synonyms	CBTF; DRBF; MMP4; MPP4; NF90; NFAR; NF110; NF90a; NF90b; NF90c; NFAR2; TCP80; DRBP76; NF110b; NFAR-1; NFAR-2; NFAR90; TCP110; MPP4110; NF90ctv; NFAR110; MPHOSPH4; NF-AT-90; ILF3
Calculated MW	95kDa
Observed MW	90kDa/100kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:1000 - 1:5000 IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunohistochemistry
Positive samples	HeLa, Raji, C6, SH-SY5Y, Mouse testis
Cellular location	Cytoplasm, Nucleus, Nucleolus
Customer validation	IHC(Homo sapiens)