제품 > 항체 > 다중클론항체(pAb)

INPP5A Rabbit pAb (A3302)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Mouse, Rat

Western blot analysis of extracts of various cell lines, using INPP5A antibody (A3302) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 30s.

Overview

Product name	INPP5A Rabbit pAb
Catalog No.	A3302
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

The protein encoded by this gene is a membrane-associated type I inositol 1, 4, 5-trisphosphate (InsP3) 5-phosphatase. InsP3 5-phosphatases hydrolyze Ins(1, 4, 5)P3, which mobilizes intracellular calcium and acts as a second messenger mediating cell responses to various stimulation.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 10-200 of human INPP5A (NP_005530.3).
Sequence	TAVLLVTANVGSLFDDPENLQKNWLREFYQVVHTHKPHFMALHCQEFGGKNYEASMSHVDKFVKELLSSDAMKEYNRARVYLDENYKSQEHFTALGSFYFLHESLKNIYQFDFKAKKYRKVAGKEIYSDTLESTPMLEKEKFPQDYFPECKWSRKGFIRTRWCIADCAFDLVNIHLFHDASNLVAWETSPS
Gene ID
Swiss Prot
Synonyms	5PTASE
Calculated MW	48kDa
Observed MW	40kDa

Applications

Reactivity	Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:2000
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 50% glycerol, pH7.3.
Key application	Western blotting
Positive samples	Mouse heart, Mouse lung, Rat testis
Cellular location	Lipid-anchor, Membrane