제품 > 항체 > 단일클론항체(mAb)

IRF6 Rabbit mAb (A3209)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Western blot analysis of various lysates using IRF6 Rabbit mAb (A3209) at 1:1000 dilution.
Secondary antibody: HRP Goat Anti-Rabbit IgG (H+L) (AS014) at 1:10000 dilution.
Lysates/proteins: 25μg per lane.
Blocking buffer: 3% nonfat dry milk in TBST.
Detection: ECL Basic Kit (RM00020).
Exposure time: 3min.

ABclonal:Immunofluorescence - IRF6 Rabbit mAb (A3209)

Immunofluorescence analysis of C6 cells using IRF6 Rabbit mAb (A3209) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of HeLa cells using IRF6 Rabbit mAb (A3209) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

Immunofluorescence analysis of NIH-3T3 cells using IRF6 Rabbit mAb (A3209) at dilution of 1:100 (40x lens). Secondary antibody: Cy3 Goat Anti-Rabbit IgG (H+L) (AS007) at 1:500 dilution. Blue: DAPI for nuclear staining.

ABclonal:Immunoprecipitation - IRF6 Rabbit mAb (A3209)

Immunoprecipitation analysis of 300 μg extracts of HepG2 cells using 3 μg IRF6 antibody (A3209). Western blot was performed from the immunoprecipitate using IRF6 antibody (A3209) at a dilution of 1:1000.

Overview

Product name	IRF6 Rabbit mAb
Catalog No.	A3209
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG
CloneNo.	ARC1928

Background

This gene encodes a member of the interferon regulatory transcription factor (IRF) family. Family members share a highly-conserved N-terminal helix-turn-helix DNA-binding domain and a less conserved C-terminal protein-binding domain. The encoded protein may be a transcriptional activator. Mutations in this gene can cause van der Woude syndrome and popliteal pterygium syndrome. Mutations in this gene are also associated with non-syndromic orofacial cleft type 6. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	A synthetic peptide corresponding to a sequence within amino acids 368-467 of human IRF6 (O14896).
Sequence	PFEIYLCFGEEWPDGKPLERKLILVQVIPVVARMIYEMFSGDFTRSFDSGSVRLQISTPDIKDNIVAQLKQLYRILQTQESWQPMQPTPSMQLPPALPPQ
Gene ID
Swiss Prot
Synonyms	LPS; PIT; PPS; VWS; OFC6; PPS1; VWS1; IRF6
Calculated MW	53kDa
Observed MW	68kDa

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	WB 1:500 - 1:1000 IF/ICC 1:50 - 1:200 IP 0.5μg-4μg antibody for 200μg-400μg extracts of whole cells
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.02% sodium azide, 0.05% BSA, 50% glycerol, pH7.3.
Key application	Western blotting Immunofluorescence Immunoprecipitation
Positive samples	293T, HepG2, A-549, Mouse lung, Mouse kidney, Rat lung, Rat liver
Cellular location	Cytoplasm, Nucleus
Customer validation	WB(Rattus norvegicus) IF(Rattus norvegicus)