제품 > 항체 > 다중클론항체(pAb)

ITGB3BP Rabbit pAb (A14859)

Tested applications:WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP InhibitionReactivity:Human, Mouse, Rat

Immunohistochemistry analysis of paraffin-embedded human liver using ITGB3BP Rabbit pAb (A14859) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human appendix using ITGB3BP Rabbit pAb (A14859) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded human gastric cancer using ITGB3BP Rabbit pAb (A14859) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Immunohistochemistry analysis of paraffin-embedded mouse brain using ITGB3BP Rabbit pAb (A14859) at dilution of 1:100 (40x lens).Perform microwave antigen retrieval with 10 mM PBS buffer pH 7.2 before commencing with IHC staining protocol.

Overview

Product name	ITGB3BP Rabbit pAb
Catalog No.	A14859
Host species	Rabbit
Purification method	Affinity purification
Isotype	IgG

Background

This gene encodes a transcriptional coregulator that binds to and enhances the activity of members of the nuclear receptor families, thyroid hormone receptors and retinoid X receptors. This protein also acts as a corepressor of NF-kappaB-dependent signaling. This protein induces apoptosis in breast cancer cells through a caspase 2-mediated signaling pathway. This protein is also a component of the centromere-specific histone H3 variant nucleosome associated complex (CENP-NAC) and may be involved in mitotic progression by recruiting the histone H3 variant CENP-A to the centromere. Alternate splicing results in multiple transcript variants.

Immunogen information

Immunogen	Recombinant fusion protein containing a sequence corresponding to amino acids 1-111 of human ITGB3BP (NP_055103.3).
Sequence	MPVKRSLKLDGLLEENSFDPSKITRKKSVITYSPTTGTCQMSLFASPTSSEEQKHRNGLSNEKRKKLNHPSLTESKESTTKDNDEFMMLLSKVEKLSEEIMEIMQNLSSIQ
Gene ID
Swiss Prot
Synonyms	CENPR; NRIF3; TAP20; CENP-R; HSU37139; ITGB3BP
Calculated MW	20kDa
Observed MW

Applications

Reactivity	Human, Mouse, Rat
Tested applications	WB IHC-P IF/ICC IP ChIP ChIP-seq RIP FC FC(Intra)ELISA MeDIP Nucleotide Array DB FACS CoIP CUT&Tag meRIP Inhibition
Recommended dilution	IHC-P 1:50 - 1:200
Storage buffer	Store at -20℃. Avoid freeze / thaw cycles. Buffer: PBS with 0.01% thimerosal, 50% glycerol, pH7.3.
Key application	Immunohistochemistry
Positive samples
Cellular location	Chromosome, Cytoplasm, Cytoplasm, Nucleus, centromere, kinetochore